DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG31220

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:296 Identity:94/296 - (31%)
Similarity:140/296 - (47%) Gaps:65/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFLCSLGSCQLAYSMFLKQP-CGKTPVP-KIISGSNASQQSAQYMA-------GIFNTTHLL--- 60
            |::|    |....:.....| |||.... ::|.|:..:.....::|       ..||....|   
  Fly    78 IYIC----CPKPANTLPSYPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPS 138

  Fly    61 CGGTIIHEDFVLTVAHCKSTQTLF----VRLGAYNINHPTDQI----RV----------IETI-A 106
            |||::|:..:|||.||| .|.|:.    ||||.:..:|..|.|    |:          :|:| :
  Fly   139 CGGSLINTRYVLTAAHC-VTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITS 202

  Fly   107 HPQY--SNSTYANDIALVKLERSVIFNLNIQPICIHLD--ATLGKQIRYYNAFGWGRTRNAEQ-S 166
            |..|  :|.|:.||||||:|:..|.:.:...|||: ||  .:|.| .:.|.| |||:|...:. |
  Fly   203 HNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICV-LDYPRSLMK-FKMYVA-GWGKTGMFDTGS 264

  Fly   167 DILQRIFVNRTNPMIC-----HLYLGMSPDPK-QICA-TTDQGDTCAGDSGGPLISKITYQGKNF 224
            .:|:...|....|..|     |.:.|    |: |||| ..|...||.||||.||:..   .|:::
  Fly   265 KVLKHAAVKVRKPEECSEKYAHRHFG----PRFQICAGGLDNRGTCDGDSGSPLMGT---SGRSY 322

  Fly   225 DT---QFGITSYGTRECNGVG---LYTDVSQYSGWI 254
            :|   ..|||||| ..|..:|   ::|..:::..||
  Fly   323 ETITFLAGITSYG-GPCGTIGWPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 85/265 (32%)
Tryp_SPc 36..257 CDD:238113 87/266 (33%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 85/265 (32%)
Tryp_SPc 104..360 CDD:238113 87/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.