DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG31205

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:270 Identity:55/270 - (20%)
Similarity:100/270 - (37%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TPVPKIISGSNASQQSAQYMAGIFN-------------TTH----------------LLCGGTII 66
            |.:...|..::..|:     .||||             |.|                |||.|.:|
  Fly    14 TTLHPTIQAASVGQE-----CGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILI 73

  Fly    67 HEDFVLTVAHCKSTQTLFVRLGAYNINHPTDQIRVIETI-AHPQYSNSTYANDIALVKLERSVIF 130
            ....|:|.|||.|........|....:..:..|.::..: .||.||...:.||:|:::|.:.|:|
  Fly    74 DSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVF 138

  Fly   131 NLNIQPICIHLDATL--GKQ-------IRYYNAFGWGRTRNAEQS-DILQRIFVNRTNPMICHLY 185
            :..:||||:...:.:  |.:       :.......:.|..:|.|. |...::...:.:...||..
  Fly   139 SDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEK 203

  Fly   186 LGMSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQF-----GITSYGTRECNGVGLYT 245
            ....|: :.||..|::         .||......:......||     .:..:.:.:.:..| |.
  Fly   204 QARFPE-ELICGHTER---------SPLSGSALTEASGTPRQFHLLGIAVAGFFSSDLDHQG-YL 257

  Fly   246 DVSQYSGWIA 255
            ::..:..||:
  Fly   258 NIRPHLDWIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 52/263 (20%)
Tryp_SPc 36..257 CDD:238113 54/265 (20%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.