DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG11664

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:252 Identity:67/252 - (26%)
Similarity:107/252 - (42%) Gaps:47/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GSNASQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHC--KST--QTLFVRLGAYNINHPTDQI 99
            |....||:..|:..|:. ...|..|::....:|||||||  |:|  :.|.||.|...|.......
  Fly    26 GIPVQQQNYGYVMQIYG-PQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGK 89

  Fly   100 RVIETIAHPQYSNSTYANDIALVKLERSVIFN--LNIQPICIHLDATLGKQIRYYNAF------- 155
            :|...:.||::|..|..||||:::::.::..:  :|...:|       .:.:...|.|       
  Fly    90 QVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLC-------SRPLTPLNMFAPPQELA 147

  Fly   156 GWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPK----QICATTDQGD-TCAGDSGGPLIS 215
            ||.....|:.   |:.:.|.......|..:.     |:    .|||:...|: .|.||||.||||
  Fly   148 GWNLMHIAQP---LKSMSVQVEPEKNCRQWF-----PQISGGVICASATMGEGLCYGDSGDPLIS 204

  Fly   216 KITYQGKNFDTQFGITSYGTRECNG---VGLYTDVSQYSGWIANIVRSKQDRSVVSR 269
            .....|         .:...|:|..   ..|:|||..:..:||..|.: .||.::|:
  Fly   205 GGEVCG---------LAIAFRKCGDKRYPALFTDVHYHRAFIAQAVLT-LDREMLSK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 61/235 (26%)
Tryp_SPc 36..257 CDD:238113 63/238 (26%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 58/225 (26%)
Tryp_SPc 38..237 CDD:214473 57/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.