DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG33226

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:279 Identity:91/279 - (32%)
Similarity:128/279 - (45%) Gaps:27/279 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFLC---SLGSCQLAYSMFLKQPCGKTPV---PKIISGSNASQQSAQYMAGIFNTTHLLCGGTI 65
            |:.:|   :|.|.:......|...|.:|||   .:|:.|.||..:...:|..|....:..|||::
  Fly    12 WLLVCFILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSL 76

  Fly    66 IHEDFVLTVAHCKSTQTLFVRLGAYNINHPT------------DQIRVIETIAHPQYSNSTYAN- 117
            |...||||.|||.|...|.||.|.|:...|.            .:|.|.....|..|.:  |.| 
  Fly    77 ISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRD--YHNY 139

  Fly   118 DIALVKLERSVIFNLNIQPICIHLDATLGK------QIRYYNAFGWGRTRNAEQSDILQRIFVNR 176
            ||||..|.:.|.:|:..:|||:...:...|      .:..:|..|||:|.:...|.|||...:..
  Fly   140 DIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFH 204

  Fly   177 TNPMICHLYLGMSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGV 241
            .:...|............|||...|..||.|||||||.:::|:.|......|||.|||...|..|
  Fly   205 LDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREV 269

  Fly   242 GLYTDVSQYSGWIANIVRS 260
            .::|:|.:||.||.:||.:
  Fly   270 TVFTNVLRYSNWIRDIVHN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 78/237 (33%)
Tryp_SPc 36..257 CDD:238113 80/239 (33%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 80/239 (33%)
Tryp_SPc 47..282 CDD:214473 78/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.