DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG33461

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:258 Identity:88/258 - (34%)
Similarity:125/258 - (48%) Gaps:20/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SMFLKQPCGKTP--VPKIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHC-KSTQT 82
            |:||::.||..|  ..|||:|:.|......:||.:...|:.||.|::|::.||||.||| :....
  Fly    25 SVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLINQWFVLTSAHCIEDDVE 89

  Fly    83 LFVRLGAYNINH-----------PTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQP 136
            |..|||..|.::           .|.:..|.....|..|....::|||.:::|||.|.:..:|||
  Fly    90 LIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQP 154

  Fly   137 ICI--HLDATL-GKQIRYYNAFGWGRTR---NAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQI 195
            |||  |....| ..||.::.|.|||.|.   |.:.|.:|..:.:.|.....|......:....||
  Fly   155 ICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQI 219

  Fly   196 CATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYSGWIANIV 258
            ||..|.|:.|.||||||....:...|.....|.||.|:....|:.|.:.|||.:|..||..:|
  Fly   220 CAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 79/236 (33%)
Tryp_SPc 36..257 CDD:238113 80/238 (34%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 79/236 (33%)
Tryp_SPc 42..281 CDD:238113 80/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463371
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.