DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and Proc

DIOPT Version :10

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_008770240.3 Gene:Proc / 25268 RGDID:3411 Length:500 Species:Rattus norvegicus


Alignment Length:290 Identity:85/290 - (29%)
Similarity:134/290 - (46%) Gaps:60/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PCGK----------------TPV-------PKIISGSNASQQSAQYMAGIFNT-THLLCGGTIIH 67
            ||||                .|.       |:|::|:...|..:.:.|.:.:: ..|.|||.:||
  Rat   220 PCGKLWKRTDKKRKNFKRDIDPEDEELELGPRIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIH 284

  Fly    68 EDFVLTVAHC-KSTQTLFVRLGAYNINH--PTD-QIRVIETIAHPQYSNSTYANDIALVKLERSV 128
            ..:|||.||| :|::.|.||||.|::..  |.: .:.:.|.:.||.|:.|...|||||::|.:..
  Rat   285 TSWVLTAAHCLESSKKLTVRLGEYDLRRRDPWELDLDIKEVLVHPNYTRSNSDNDIALLRLSQPA 349

  Fly   129 IFNLNIQPICIHLDATLGKQIRYYN----AFGWGRTRNAEQSDILQRIFVNRT-------NPMI- 181
            ..:..|.|||:. ::.|.:::....    ..|||     .|||.::....|||       .|:. 
  Rat   350 TLSKTIVPICLP-NSGLAQELSQAGQETVVTGWG-----YQSDKVKDGRRNRTFILTFIRIPLAA 408

  Fly   182 ---CHLYLGMSPDPKQICA--TTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTREC--- 238
               |...:........:||  ..|..|.|.||||||::  :.::|..|  ..|:.|:| ..|   
  Rat   409 RNDCMQVMNNVVSENMLCAGIIGDTRDACDGDSGGPMV--VFFRGTWF--LVGLVSWG-EGCGHL 468

  Fly   239 NGVGLYTDVSQYSGWIANIVRSKQDRSVVS 268
            |..|:||.|..|..||.:.: .::|.|:.|
  Rat   469 NNYGVYTKVGSYLKWIHSYI-GERDVSLKS 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 36..257 CDD:238113 76/245 (31%)
ProcXP_008770240.3 GLA 65..125 CDD:214503
EGF_CA 126..170 CDD:238011
FXa_inhibition 178..213 CDD:464251
Tryp_SPc 252..486 CDD:238113 76/244 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.