DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG30289

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:257 Identity:87/257 - (33%)
Similarity:127/257 - (49%) Gaps:27/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SMFLKQPCGKTP----VPKIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHCKSTQ 81
            |..|.:.||.:.    ||.|..|:..:.|...:|..::::..  |||::|...||||.|||.|.:
  Fly    23 SRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKP--CGGSLIARQFVLTAAHCVSFE 85

  Fly    82 TLFVRLGAYNINHPTD------------QIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNI 134
            .|:||||.|....|..            .|.|...|.|..|:..|..|||||:::..:|.::..:
  Fly    86 DLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAVEYSDYV 150

  Fly   135 QPICIHLDATLGKQ---IRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQIC 196
            :|||:    .:|:|   |..:...|||.|...:.|.||....:...:...|::......|..|||
  Fly   151 RPICL----LVGEQMQSIPMFTVTGWGETEYGQFSRILLNATLYNMDISYCNIKFNKQADRSQIC 211

  Fly   197 ATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTREC--NGVGLYTDVSQYSGWIAN 256
            |.:...:||.|||||||.||..|..:....|:|:.|||:..|  |..|:||:||.:..||.|
  Fly   212 AGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWIFN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 78/235 (33%)
Tryp_SPc 36..257 CDD:238113 81/238 (34%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 78/234 (33%)
Tryp_SPc 42..271 CDD:238113 78/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.