DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG30288

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:279 Identity:93/279 - (33%)
Similarity:139/279 - (49%) Gaps:32/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFVWIFLCSLGSCQLAYSMFLKQPCGKTPV----PKIISGSNASQQSAQYMAGIFNTTHLLCGGT 64
            ||:.|.....|       ..|:..||.|..    .:|..|.:|..:|..:|..:..:...:|||:
  Fly    14 LFIGIIRTESG-------RLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGS 71

  Fly    65 IIHEDFVLTVAHCKSTQTLFVRLGAYNINHP------------TDQIRVIETIAHPQYSNSTYAN 117
            :|...||||..||.|...:.||||.|:..||            ...:.|...|.|   ||..|  
  Fly    72 LITARFVLTAEHCISPMYMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVH---SNPGY-- 131

  Fly   118 DIALVKLERSVIFNLNIQPICIHLDATLG---KQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNP 179
            ||.|::::|||||:..::|||:.|..|||   ..|..:|..|||...:.|:.|.||...:.:...
  Fly   132 DIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQLPQ 196

  Fly   180 MICHLYLGMSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLY 244
            ..|. ..|...|...|||.:...|:|.|||||||.:..|::|:....|||:.|.|.|.|:|:|:|
  Fly   197 WSCE-RPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGLGIY 260

  Fly   245 TDVSQYSGWIANIVRSKQD 263
            |:|:.::.||.:::::..|
  Fly   261 TNVTHFTDWILDVIQNHSD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 82/233 (35%)
Tryp_SPc 36..257 CDD:238113 84/235 (36%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 82/233 (35%)
Tryp_SPc 45..270 CDD:238113 81/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.