DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG30087

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:269 Identity:92/269 - (34%)
Similarity:140/269 - (52%) Gaps:26/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 W--IFLCSLGSCQLAYSMFLKQPCGKT----PVPKIISGSNASQQSAQYMAGIFNTTHLLCGGTI 65
            |  |.:|.:...::..:.||...||.|    ...::::|..|..:||.:|..:.|.:...|||:|
  Fly     7 WFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSI 71

  Fly    66 IHEDFVLTVAHCKSTQTLFVRLGAYNINHPTD-----------QIRVIETIAHPQYSNSTYANDI 119
            ::..::||.||| ....|.:|||.:||....|           :..:::.|.|..|:.:.:.|||
  Fly    72 LNSRYILTAAHC-VFPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDI 135

  Fly   120 ALVKLERSVIFNLNIQPICIHLDATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMIC-- 182
            ||:||.||:.||::||||||.|:......:..|..||||.|:......:||...:...:...|  
  Fly   136 ALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSR 200

  Fly   183 --HLYLGMSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYT 245
              |.|:    :..||||..::.|||||||||||::::.:.|.....|.||.|||..:|...|:||
  Fly   201 SFHAYM----NGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYT 261

  Fly   246 DVSQYSGWI 254
            .|..|..||
  Fly   262 YVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 82/233 (35%)
Tryp_SPc 36..257 CDD:238113 84/234 (36%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 82/233 (35%)
Tryp_SPc 42..272 CDD:238113 84/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463420
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.