DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG30083

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:254 Identity:97/254 - (38%)
Similarity:140/254 - (55%) Gaps:10/254 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AYSMFLKQPCGKTPV-PKIISGSNASQQSAQYMAGIF-----NTTHLLCGGTIIHEDFVLTVAHC 77
            |.|.||:..||...: |||:.|.||...:..:||.||     ....|:||||:||:.|||:.|||
  Fly    16 AMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHC 80

  Fly    78 -KSTQTLFVRLGAYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHL 141
             |..|.|.||||.::.:.   ...|.:...:..::..:|:|||.:::::..|.||..|:||||..
  Fly    81 IKRDQILAVRLGEHSSSR---YFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIIT 142

  Fly   142 DATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQICATTDQGDTCA 206
            |.|....::.:.|.|||:|.|...|.:|:.:.:|..|...|:..|.::....||||....|||||
  Fly   143 DPTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTESQICAGHPDGDTCA 207

  Fly   207 GDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYSGWIANIVRSKQDRS 265
            ||||||||..:...|.....|.||.|:|:..||..|:||.:|.:..||..:|.:...||
  Fly   208 GDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFIDWILMVVDNYTVRS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 85/224 (38%)
Tryp_SPc 36..257 CDD:238113 86/226 (38%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 85/224 (38%)
Tryp_SPc 34..255 CDD:238113 84/223 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463399
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.