DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG30002

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:304 Identity:92/304 - (30%)
Similarity:134/304 - (44%) Gaps:68/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VWIFLCSLGSC---------------QLAYSMFLKQPCG--KTPVP------KIISGSNASQQSA 47
            ||..||.  :|               :|.|....:|.||  ...:|      .|..|..:|..|.
  Fly    11 VWGILCL--TCPPLSEAGMEDWTPGQRLVYENLTQQDCGVRSNQIPAVRIRFMITGGRKSSLMSQ 73

  Fly    48 QYMAGIFNTTHL---LCGGTIIHEDFVLTVAH----CKSTQTLFVRLG-----------AYNINH 94
            .:||.:...:.|   .|||::|.|.||||.||    |..::.:.|.||           .||...
  Fly    74 PWMAFLHIASDLEMCRCGGSLISELFVLTAAHCFKMCPRSKEIRVWLGELDLSSTSDCTTYNYER 138

  Fly    95 ----PTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHL-------DATLGKQ 148
                |.::..:.:.|.|.:::......||||:||.:.|:|..:|:|||:.|       ...||::
  Fly   139 VCAPPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQR 203

  Fly   149 IRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQICATTDQGDTCAGDSGGPL 213
               :.|.|||:|.:...::....:.: ||....      ...|...:||:.|..|||.|||||||
  Fly   204 ---FMAVGWGKTESLRYANSTMEVDI-RTEKCT------DGRDTSFLCASGDYVDTCNGDSGGPL 258

  Fly   214 ISKITYQGKNFDTQFGITSYGTRECNGVG---LYTDVSQYSGWI 254
            :.|.|..||:...|||:.|.|::.| |.|   .|.||..|..||
  Fly   259 LWKTTLFGKDRAVQFGVVSTGSQNC-GAGHKAYYMDVPTYMPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 79/250 (32%)
Tryp_SPc 36..257 CDD:238113 81/251 (32%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 79/249 (32%)
Tryp_SPc 62..301 CDD:238113 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.