DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG43336

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:262 Identity:92/262 - (35%)
Similarity:134/262 - (51%) Gaps:26/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LGSCQLAYSMFLKQPCG----KTPVPKIISGSNASQQSAQYMAGIFNTT-HLLCGGTIIHEDFVL 72
            |||.|     ||...||    ...||::.:|:.||..|:.:||.:.:|. ..:|||::|....||
  Fly    16 LGSTQ-----FLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVL 75

  Fly    73 TVAHCKSTQT-LFVRLGAYN-----INHPTDQIRVIETIA-----HPQYSNSTYANDIALVKLER 126
            |.|||...:| |..|||.|:     :.|.:.....||.:.     |..|:..|.|.|||:::|.|
  Fly    76 TAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYR 140

  Fly   127 SVIFNLNIQPICIHLDATLGKQIRYYNAF---GWGRTRNAEQSDILQRIFVNRTNPMICHLYLGM 188
            .|.:..||:||||.:|....|.|...:..   |||:|.:...|..|:.:.:.|.:|.:|..|..:
  Fly   141 KVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKHPEVCRRYATL 205

  Fly   189 SPDPKQICATTDQGDTCAGDSGGPLISKITY-QGKNFDTQFGITSYGTRECNGVGLYTDVSQYSG 252
            |....|.||..::.:.|.||||||:.:.|.| :.|.| .|.||.|:...:|..|.::|||..|..
  Fly   206 SLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRF-VQVGIASFTNTQCVMVSVFTDVMSYVD 269

  Fly   253 WI 254
            ||
  Fly   270 WI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 80/234 (34%)
Tryp_SPc 36..257 CDD:238113 82/235 (35%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 80/234 (34%)
Tryp_SPc 40..271 CDD:238113 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463455
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.