DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG43124

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:105/260 - (40%) Gaps:44/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFLCSL-----GSCQLAYSMFLKQPCGKTPVPKIISGSNASQQSAQYMAGIFNTTHLLCGGTII 66
            ||.||.:     ||.|.     |::.|  ....:.|:||:    .|.::|.|.:.:.::|.|.:|
  Fly     6 WIVLCIVLMFYQGSAQT-----LEEDC--VDHMERINGSS----YAPWLAEILSDSKVICAGALI 59

  Fly    67 HEDFVLTVAHC-KSTQTLFVRLGAYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIF 130
            :..:|||.|.| |..:.|.||||:...:...:..||.:......:..:...|::.:.:|:..|.|
  Fly    60 NNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFRVTKAYFWMTHFPANNTNNLCIFRLQTEVEF 124

  Fly   131 NLNIQPICIHLDATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQI 195
            ..:|:|:||         .:...:.|...|............|......:.|....|.:.:..| 
  Fly   125 KTHIRPMCI---------TKSPKSLGLATTFEIINEKPKMWYFCKNIKGLFCKYVFGENEEKWQ- 179

  Fly   196 CATTDQGDTCAGDSGGP---LISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYSGWIANI 257
                      :..:|.|   .||...::|.   .::||.||...:... .:|.:|..:..|||.|
  Fly   180 ----------SKPTGSPWTETISNGPFKGL---VRYGILSYRDNKTYD-EVYINVMSHINWIAQI 230

  Fly   258  257
              Fly   231  230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 47/222 (21%)
Tryp_SPc 36..257 CDD:238113 50/224 (22%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.