powered by:
Protein Alignment CG43235 and Agbl3
DIOPT Version :9
Sequence 1: | NP_001245931.1 |
Gene: | CG43235 / 12798301 |
FlyBaseID: | FBgn0262880 |
Length: | 103 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001276585.1 |
Gene: | Agbl3 / 76223 |
MGIID: | 1923473 |
Length: | 1006 |
Species: | Mus musculus |
Alignment Length: | 47 |
Identity: | 12/47 - (25%) |
Similarity: | 19/47 - (40%) |
Gaps: | 5/47 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 LLKDTDNYNLWHRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKN 95
|.|.|.::.||.:....|.:..|..| ||....|:...::..|
Mouse 921 LQKKTKHFELWGKKAKDVQLATSQWE-----AVPLSSNMDASIIRGN 962
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2866 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.