DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and Cpa4

DIOPT Version :9

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_017177239.1 Gene:Cpa4 / 71791 MGIID:1919041 Length:469 Species:Mus musculus


Alignment Length:119 Identity:22/119 - (18%)
Similarity:45/119 - (37%) Gaps:26/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RPQIAMLLLITAWKSSLSDPIGPRS---------YENYSVYKVFIKTRSDQQVIDGLLKDTDNYN 57
            || ..::|..:.|.......:..|.         :....|:::.::..      |.:.|.|:..|
Mouse    37 RP-FPLILSSSVWDGGFGGLLASRKLTIIFFSLPFSRDQVFRINVRNG------DEIRKLTELVN 94

  Fly    58 LWHRGLNV----------VHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLID 101
            ..|..|:|          |.|:|..|......:.::.:.:...|.|:::|.|:|
Mouse    95 SDHLKLSVWKSPSTFDRPVDILVPSVSLLPVKSFLKSQGLDYSVTIEDLQALLD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 16/78 (21%)
Cpa4XP_017177239.1 Propep_M14 81..150 CDD:366995 16/74 (22%)
M14_CPA 166..467 CDD:349442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.