DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and cpb2

DIOPT Version :9

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001025617.1 Gene:cpb2 / 595005 XenbaseID:XB-GENE-969491 Length:421 Species:Xenopus tropicalis


Alignment Length:78 Identity:22/78 - (28%)
Similarity:38/78 - (48%) Gaps:12/78 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VFIKTRSDQQVIDGLLKDTDNYN---LWHRGLN-------VVHIMVSPVEKDSFLAVMQKENIVV 89
            :::..|:||||  .:||:..:..   ||....|       .||..|:....|:..|.:.:.:|:.
 Frog    28 LYVLPRTDQQV--EILKNITSQPEIVLWKPDSNEHIMKNKEVHFYVNESFIDTVKAELNESSILY 90

  Fly    90 EVLIKNVQTLIDR 102
            .||:.|.|.||::
 Frog    91 MVLVNNAQELIEQ 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 22/76 (29%)
cpb2NP_001025617.1 Propep_M14 33..104 CDD:366995 22/73 (30%)
M14_CPB2 118..418 CDD:349465
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.