DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and CPA4

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_057436.2 Gene:CPA4 / 51200 HGNCID:15740 Length:421 Species:Homo sapiens


Alignment Length:83 Identity:14/83 - (16%)
Similarity:36/83 - (43%) Gaps:4/83 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GPRSYENYSVYKVFIKTRSDQQVIDGLLKDTD-NYNLWHRGLNV---VHIMVSPVEKDSFLAVMQ 83
            |...:....|.::.::...:...:..|:...: ..|.|....:.   |.::|..|...:|.:.::
Human    17 GQEKFFGDQVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLR 81

  Fly    84 KENIVVEVLIKNVQTLID 101
            .:.:...|.|:::|.|:|
Human    82 SQGLEYAVTIEDLQALLD 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 12/73 (16%)
CPA4NP_057436.2 Propep_M14 27..101 CDD:460505 12/73 (16%)
M14_CPA 118..419 CDD:349442
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.