DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and cpb1

DIOPT Version :9

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_031758320.1 Gene:cpb1 / 496994 XenbaseID:XB-GENE-853710 Length:414 Species:Xenopus tropicalis


Alignment Length:107 Identity:21/107 - (19%)
Similarity:48/107 - (44%) Gaps:18/107 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNVVHIMV 70
            |:|||::....|..    ||::....|::|..:.....::|..:.: |:..:.|   |.....:|
 Frog     3 ALLLLVSLAAVSAE----PRNFHGEKVFRVIPQNAEHVELIKSMAQ-TEGLDFW---LPDSAQLV 59

  Fly    71 SPVEKDSF----------LAVMQKENIVVEVLIKNVQTLIDR 102
            ...::..|          .|::|:..:..|:||.::|..:::
 Frog    60 EQGKRADFHADGHVSYEVQALLQQSGMPYEILINDLQDALEK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 13/77 (17%)
cpb1XP_031758320.1 Propep_M14 31..102 CDD:396700 12/75 (16%)
M14_CPB 111..410 CDD:349443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.