powered by:
Protein Alignment CG43235 and agbl5
DIOPT Version :9
Sequence 1: | NP_001245931.1 |
Gene: | CG43235 / 12798301 |
FlyBaseID: | FBgn0262880 |
Length: | 103 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017210489.1 |
Gene: | agbl5 / 445479 |
ZFINID: | ZDB-GENE-040822-29 |
Length: | 886 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 12/70 - (17%) |
Similarity: | 26/70 - (37%) |
Gaps: | 8/70 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 KVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQT 98
::.::......||.....:|....:|. ::.|..|.....|..|:.:..:.|:||...
Zfish 818 RIPVRRELQSSVIPLSSTETPTMRVWK--------LIKPGLKKHLAGVSGKDRLSTKALLKNSSR 874
Fly 99 LIDRY 103
..|::
Zfish 875 QTDQH 879
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG43235 | NP_001245931.1 |
Propep_M14 |
34..102 |
CDD:280416 |
11/67 (16%) |
agbl5 | XP_017210489.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2866 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.