DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and Cpa5

DIOPT Version :9

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001002808.2 Gene:Cpa5 / 408212 RGDID:1303098 Length:436 Species:Rattus norvegicus


Alignment Length:101 Identity:24/101 - (23%)
Similarity:43/101 - (42%) Gaps:20/101 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTD-----NYNLWH---RGLNV 65
            :|..||        |..::....|.:|..|  :::|:  .||:|.:     ..:.|.   |....
  Rat    27 ILAVAW--------GQVNFTGDQVLRVLAK--NEKQL--SLLRDLEIQKPQKVDFWRGPARPSLP 79

  Fly    66 VHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLID 101
            |.:.|...|..|..|.::...:...|:||::|.|:|
  Rat    80 VDMRVPFSELPSVKAYLKSHGLAYSVMIKDIQVLLD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 19/76 (25%)
Cpa5NP_001002808.2 Propep_M14 48..117 CDD:396700 18/72 (25%)
M14_CPA 134..434 CDD:349442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.