DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and CG8562

DIOPT Version :9

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster


Alignment Length:75 Identity:15/75 - (20%)
Similarity:33/75 - (44%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNVVH---IMVSPVEKDSFLAVMQKEN 86
            :.||.|.:|:|...|.....::..|  ....|:.......:.|   ::|||.:...|..:::.|.
  Fly    21 QDYEGYRIYEVIPSTADQADLLHQL--SLQGYDFISETRLLGHPSRVIVSPAQLKHFQQLVEAEK 83

  Fly    87 IVVEVLIKNV 96
            :.:.::..|:
  Fly    84 MTLTLVNSNL 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 11/66 (17%)
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416 11/66 (17%)
M14_CP_A-B_like 124..420 CDD:199844
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.