DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and CG2915

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster


Alignment Length:86 Identity:18/86 - (20%)
Similarity:35/86 - (40%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNV---VHIMVSPVEKDSFLAV 81
            :|.....|:||.:|.|..:.:...::...|.:.:|:.........|   :.|:|:.........:
  Fly    48 NPPDQARYDNYRIYNVEFENQEQIELFQKLEEQSDSLTFIGHAREVGQKLSILVAAHRVADIADL 112

  Fly    82 MQKENIVVEVLIKNVQTLIDR 102
            ::...:...||..|.|..|||
  Fly   113 LKTYKVKHRVLTYNFQEKIDR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 12/71 (17%)
CG2915NP_610338.1 Propep_M14 61..133 CDD:460505 12/71 (17%)
M14_CP_A-B_like 154..444 CDD:349433
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.