DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and CG18585

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_609132.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster


Alignment Length:101 Identity:33/101 - (32%)
Similarity:55/101 - (54%) Gaps:7/101 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAMLLLITAWKSSLSDPIGPRS-YENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLW---HRGLNV 65
            :|.|:.:|: ...|.|  .|:. |:|:.|||:.|:.:.....|:.:.:.|..||:|   ......
  Fly     7 LATLVALTS-AGILKD--SPKERYDNFRVYKLTIQNKIQLAAIEKIGELTKKYNIWKEYDERSRQ 68

  Fly    66 VHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLID 101
            :.|||||.|.:.|..:::..||..|::|:|||..||
  Fly    69 IDIMVSPGELNHFQELLKFNNISSELMIENVQERID 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 24/72 (33%)
CG18585NP_609132.1 Propep_M14 33..106 CDD:460505 24/72 (33%)
M14_CP_A-B_like 122..412 CDD:349433
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.