DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and cpa1

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001018318.1 Gene:cpa1 / 325886 ZFINID:ZDB-GENE-050522-438 Length:418 Species:Danio rerio


Alignment Length:106 Identity:28/106 - (26%)
Similarity:51/106 - (48%) Gaps:21/106 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNL-----W----HRGL 63
            ||::||...::   .|..::|...|.:  |..::.:|:  .|||:....:|     |    ...|
Zfish     4 LLVLTALFVAV---FGKVTFEGDQVLR--INAKNAEQI--SLLKELTEADLLGLDFWMNPARESL 61

  Fly    64 NV-VHIMVSPVEK-DSFLAVMQKENIVVEVLIKNVQTLIDR 102
            .| :|:....::. .:|||..|   |...::|:|||.|:|:
Zfish    62 PVDLHVPFHSLQAVRAFLAYNQ---IPYHIMIENVQDLVDK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 20/79 (25%)
cpa1NP_001018318.1 Propep_M14 26..100 CDD:460505 21/81 (26%)
M14_CPA 117..416 CDD:349442
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.