| Sequence 1: | NP_001245931.1 | Gene: | CG43235 / 12798301 | FlyBaseID: | FBgn0262880 | Length: | 103 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001315354.1 | Gene: | cpb1 / 322412 | ZFINID: | ZDB-GENE-030131-1132 | Length: | 416 | Species: | Danio rerio |
| Alignment Length: | 35 | Identity: | 8/35 - (22%) |
|---|---|---|---|
| Similarity: | 21/35 - (60%) | Gaps: | 2/35 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 66 VHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLI 100 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43235 | NP_001245931.1 | Propep_M14 | 33..102 | CDD:460505 | 8/35 (23%) |
| cpb1 | NP_001315354.1 | Propep_M14 | 26..102 | CDD:460505 | 8/35 (23%) |
| M14_CPB | 112..412 | CDD:349443 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||