DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and cpb1

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001315354.1 Gene:cpb1 / 322412 ZFINID:ZDB-GENE-030131-1132 Length:416 Species:Danio rerio


Alignment Length:35 Identity:8/35 - (22%)
Similarity:21/35 - (60%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLI 100
            :|:..:.:...|  .::|:.::.|:|:|.|:|..:
Zfish    67 IHVPAAQLAMVS--TILQQSDMEVKVMIDNLQEAV 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 8/35 (23%)
cpb1NP_001315354.1 Propep_M14 26..102 CDD:460505 8/35 (23%)
M14_CPB 112..412 CDD:349443
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.