powered by:
Protein Alignment CG43235 and CG31019
DIOPT Version :9
Sequence 1: | NP_001245931.1 |
Gene: | CG43235 / 12798301 |
FlyBaseID: | FBgn0262880 |
Length: | 103 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_733391.1 |
Gene: | CG31019 / 318558 |
FlyBaseID: | FBgn0051019 |
Length: | 659 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 16/60 - (26%) |
Similarity: | 29/60 - (48%) |
Gaps: | 13/60 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 DPIGP--RSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNVVHIMVSPVEKDS 77
|...| |.:.|::|..| :.||:|:..::..:.:.||:..|| :|:.|.|
Fly 82 DTCNPRFRFWFNFTVDNV----KQDQRVLFHIVNISKSRNLFSSGL-------TPLVKSS 130
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG43235 | NP_001245931.1 |
Propep_M14 |
34..102 |
CDD:280416 |
11/44 (25%) |
CG31019 | NP_733391.1 |
M14_AGBL4_like |
190..478 |
CDD:133118 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2866 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.