DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and Cpa2

DIOPT Version :9

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001013101.2 Gene:Cpa2 / 296959 RGDID:1305563 Length:417 Species:Rattus norvegicus


Alignment Length:37 Identity:9/37 - (24%)
Similarity:20/37 - (54%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLIDR 102
            ||:.|......:....::.:.|...::|::||.|:|:
  Rat    63 VHVRVPFASIQAVKVFLESQGIDYSIMIEDVQVLLDQ 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 8/35 (23%)
Cpa2NP_001013101.2 Propep_M14 33..100 CDD:396700 9/37 (24%)
M14_CPA 116..415 CDD:349442
Substrate binding. /evidence=ECO:0000250|UniProtKB:P00730 177..180
Substrate binding. /evidence=ECO:0000250|UniProtKB:P00730 252..253
Substrate binding. /evidence=ECO:0000250|UniProtKB:P00730 305..306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.