powered by:
Protein Alignment CG43235 and Cpa2
DIOPT Version :9
Sequence 1: | NP_001245931.1 |
Gene: | CG43235 / 12798301 |
FlyBaseID: | FBgn0262880 |
Length: | 103 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001019869.1 |
Gene: | Cpa2 / 232680 |
MGIID: | 3617840 |
Length: | 417 |
Species: | Mus musculus |
Alignment Length: | 37 |
Identity: | 9/37 - (24%) |
Similarity: | 19/37 - (51%) |
Gaps: | 0/37 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 VHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLIDR 102
||:.|...........::.:.|...::|::||.|:|:
Mouse 63 VHVRVPFASIQDVKVFLESQGITYSIMIEDVQVLLDQ 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2866 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000056 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.