DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and ZC434.9

DIOPT Version :9

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001251356.1 Gene:ZC434.9 / 172908 WormBaseID:WBGene00013895 Length:720 Species:Caenorhabditis elegans


Alignment Length:108 Identity:25/108 - (23%)
Similarity:50/108 - (46%) Gaps:16/108 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RPQIAMLLLITAW--KSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGL--LKDTDNYNL--WH 60
            |..:.:|:||:|:  .:.::|...|:       ::|.....:|...:..|  :.:...::|  |.
 Worm     7 RNTLWLLILISAFAINAEIADDKPPK-------FQVLRAHATDVPQLKALRDIHERTQHDLDFWQ 64

  Fly    61 RGLNVVH---IMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLI 100
            ....|.|   |||.....:...:|::..||..:|:|::|..||
 Worm    65 TPSKVGHRADIMVDEDRMEWLDSVLKNSNISYDVIIEDVGKLI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 18/74 (24%)
ZC434.9NP_001251356.1 Propep_M14 45..111 CDD:366995 16/63 (25%)
M14_CP_A-B_like 141..454 CDD:349433
ShK 682..719 CDD:366702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.