DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG43235 and ccpp-1

DIOPT Version :9

Sequence 1:	NP_001245931.1	Gene:	CG43235 / 12798301	FlyBaseID:	FBgn0262880	Length:	103	Species:	Drosophila melanogaster
Sequence 2:	NP_491674.2	Gene:	ccpp-1 / 172241	WormBaseID:	WBGene00018995	Length:	1015	Species:	Caenorhabditis elegans

Alignment Length:	137	Identity:	31/137 - (22%)
Similarity:	49/137 - (35%)	Gaps:	57/137 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 MLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTR--------------SDQQVIDGLLKDTDNYN 57
            :|.||.:..||.:|    |..|.|.|....|.|.              :|:..||..|.:.
Worm    93 LLHLIFSHFSSEND----RKKEKYIVKCDVIATLTRITRKRIIMTLDVTDESSIDHNLDEV---- 149

  Fly    58 LW---HR-GLNVVHI--------MVSP-----VEKDS----FL--------------AVMQKENI 87
            ||   |: ||....:        ::||     ::||:    ||              |:.:.|..
Worm   150 LWKLLHKIGLKDPRVSLKVRMGGLISPMCKLFIQKDTLPELFLPFFIKISRSPRNGQAIGRYEGF 214

  Fly    88 VVEVLIK 94
            :..:|:|
Worm   215 MTRLLVK 221

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG43235	NP_001245931.1	Propep_M14	34..102	CDD:280416	21/110 (19%)
ccpp-1	NP_491674.2	M14_Nna1_like_2	738..1011	CDD:199859
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2866
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900