powered by:
Protein Alignment CG43235 and ccpp-1
DIOPT Version :9
Sequence 1: | NP_001245931.1 |
Gene: | CG43235 / 12798301 |
FlyBaseID: | FBgn0262880 |
Length: | 103 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491674.2 |
Gene: | ccpp-1 / 172241 |
WormBaseID: | WBGene00018995 |
Length: | 1015 |
Species: | Caenorhabditis elegans |
Alignment Length: | 137 |
Identity: | 31/137 - (22%) |
Similarity: | 49/137 - (35%) |
Gaps: | 57/137 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 MLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTR--------------SDQQVIDGLLKDTDNYN 57
:|.||.:..||.:| |..|.|.|....|.|. :|:..||..|.:.
Worm 93 LLHLIFSHFSSEND----RKKEKYIVKCDVIATLTRITRKRIIMTLDVTDESSIDHNLDEV---- 149
Fly 58 LW---HR-GLNVVHI--------MVSP-----VEKDS----FL--------------AVMQKENI 87
|| |: ||....: ::|| ::||: || |:.:.|..
Worm 150 LWKLLHKIGLKDPRVSLKVRMGGLISPMCKLFIQKDTLPELFLPFFIKISRSPRNGQAIGRYEGF 214
Fly 88 VVEVLIK 94
:..:|:|
Worm 215 MTRLLVK 221
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG43235 | NP_001245931.1 |
Propep_M14 |
34..102 |
CDD:280416 |
21/110 (19%) |
ccpp-1 | NP_491674.2 |
M14_Nna1_like_2 |
738..1011 |
CDD:199859 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2866 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.