DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and T06A4.1

DIOPT Version :9

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_871809.1 Gene:T06A4.1 / 171669 WormBaseID:WBGene00020281 Length:606 Species:Caenorhabditis elegans


Alignment Length:80 Identity:16/80 - (20%)
Similarity:36/80 - (45%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YENYSVYKVFIKTRSDQQVIDGLLKDTDNYNL--WHRGLN---VVHIMVSPVEKDSFLAVMQKEN 86
            |.|:.:.::..:|....:.:..|.:|...|.|  |....|   :|.:.|:|.:...|:..::.:.
 Worm    29 YHNFKLIRINPETEGSVKYLRSLYEDPSPYELDFWQPPTNIGAIVDLTVAPADAPRFVKDLESKK 93

  Fly    87 IVVEVLIKNVQTLID 101
            |...|.:.::...|:
 Worm    94 ISYIVAVNDLSKAIE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 14/73 (19%)
T06A4.1NP_871809.1 Propep_M14 40..110 CDD:366995 14/69 (20%)
M14_CP_A-B_like 128..435 CDD:349433
ShK 568..602 CDD:366702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.