DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and CPB2

DIOPT Version :9

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001863.3 Gene:CPB2 / 1361 HGNCID:2300 Length:423 Species:Homo sapiens


Alignment Length:86 Identity:22/86 - (25%)
Similarity:36/86 - (41%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SYENYSVYKVFIKTRSDQQVIDGLLKDTDNYN--LWH---RGLNV----VHIMVSPVEKDSFLAV 81
            ::::..|.....:|....||:..|   |..|.  ||.   ..|.|    ||..|:..:.|:..|.
Human    22 AFQSGQVLAALPRTSRQVQVLQNL---TTTYEIVLWQPVTADLIVKKKQVHFFVNASDVDNVKAH 83

  Fly    82 MQKENIVVEVLIKNVQTLIDR 102
            :....|...||:.:|:.||.:
Human    84 LNVSGIPCSVLLADVEDLIQQ 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 21/76 (28%)
CPB2NP_001863.3 Propep_M14 33..104 CDD:280416 21/73 (29%)
M14_CPB2 119..420 CDD:199868
Substrate binding. /evidence=ECO:0000250|UniProtKB:P00730 181..184
Substrate binding. /evidence=ECO:0000250|UniProtKB:P00730 256..257
Substrate binding. /evidence=ECO:0000250|UniProtKB:P00730 311..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.