DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and CPB1

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001862.2 Gene:CPB1 / 1360 HGNCID:2299 Length:417 Species:Homo sapiens


Alignment Length:104 Identity:20/104 - (19%)
Similarity:47/104 - (45%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWH-------RG 62
            :|:|:|:|...:|...  |...:|...|::|.::..:...:|.. |..|...:.|.       :.
Human     2 LALLVLVTVALASAHH--GGEHFEGEKVFRVNVEDENHINIIRE-LASTTQIDFWKPDSVTQIKP 63

  Fly    63 LNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLID 101
            .:.|...|...:..:...|:::..:..:|||.|::.:::
Human    64 HSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 12/76 (16%)
CPB1NP_001862.2 Propep_M14 28..104 CDD:460505 12/76 (16%)
M14_CPB 114..413 CDD:349443
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.