DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and Cpa3

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus


Alignment Length:101 Identity:21/101 - (20%)
Similarity:48/101 - (47%) Gaps:10/101 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHR------GLNV-V 66
            ||:....::|:  |.|..::...|::|.::......|:..|.:..: .:.|:.      .:|: |
Mouse     5 LLMAVIYTTLA--IAPVHFDREKVFRVKLQNEKHASVLKNLTQSIE-LDFWYPDAIHDIAVNMTV 66

  Fly    67 HIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLIDR 102
            ...||..|..:..:.:::..|..|:||.::|..|::
Mouse    67 DFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 15/75 (20%)
Cpa3NP_031779.1 Propep_M14 27..103 CDD:460505 15/77 (19%)
Peptidase_M14_like 114..413 CDD:472171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.