DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diedel2 and Diedel3

DIOPT Version :9

Sequence 1:NP_001247357.1 Gene:Diedel2 / 12798297 FlyBaseID:FBgn0262873 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_001097028.1 Gene:Diedel3 / 50358 FlyBaseID:FBgn0085358 Length:121 Species:Drosophila melanogaster


Alignment Length:102 Identity:38/102 - (37%)
Similarity:61/102 - (59%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTIAIFWLACINFASSTCCTFAATLHFKIRGGVCGVVGAKSNGTGCKITICPNGEALVGSYCGKA 68
            |.|.:.|::|...:.:.||...|.|.|.:..|.||:|.||:...||:.|:|.:|..|.|:|||..
  Fly     9 LLILVVWVSCFGESGADCCWTKAKLLFTMGTGSCGMVNAKTTKYGCEATVCADGRVLKGTYCGVG 73

  Fly    69 ACDVFGCQCIRGCLQGSFAKDFLKKNYIHGIELLGTE 105
            :|::.||.|..|||.|::.:.|::.|..:.|.|:.|:
  Fly    74 SCNIIGCFCRGGCLTGNYGESFVEINNRYQINLISTQ 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diedel2NP_001247357.1 DUF4002 22..94 CDD:289908 29/71 (41%)
Diedel3NP_001097028.1 DUF4002 27..99 CDD:289908 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016639
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.