DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diedel2 and Diedel

DIOPT Version :9

Sequence 1:NP_001247357.1 Gene:Diedel2 / 12798297 FlyBaseID:FBgn0262873 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_651695.1 Gene:Diedel / 43474 FlyBaseID:FBgn0039666 Length:115 Species:Drosophila melanogaster


Alignment Length:104 Identity:41/104 - (39%)
Similarity:66/104 - (63%) Gaps:1/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTIAIFWLACINFASSTCCTFAATLHFKIRGGVCGVVGAKSN-GTGCKITICPNGEALVGSYCGK 67
            |.:.|..||.::.|.|.|||....:.||:..|.|..|.|..| ..||::|||.:|.|.:|:|||:
  Fly     9 LLVGICALAFVHVARSECCTSRELVEFKMDRGDCEAVRAIENYPNGCEVTICADGVAQLGAYCGQ 73

  Fly    68 AACDVFGCQCIRGCLQGSFAKDFLKKNYIHGIELLGTER 106
            .:|::|||.|..|||.|.::::|:::|..:||:::...|
  Fly    74 GSCNIFGCNCDGGCLSGDWSQEFVRRNQQYGIQIIKVTR 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diedel2NP_001247357.1 DUF4002 22..94 CDD:289908 30/72 (42%)
DiedelNP_651695.1 DUF4002 27..100 CDD:289908 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016639
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.