DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG18754

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:153 Identity:47/153 - (30%)
Similarity:76/153 - (49%) Gaps:37/153 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSALFLEQNCGKSS-VF----------SPAPWLVKIRPELSSNITCTGTLINERFVLTAASCI-- 69
            |..|..:|.||::: ||          :..||:|.:..|...::.        |:|||||.|:  
  Fly    88 GDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRLSLI--------RYVLTAAHCVIG 144

  Fly    70 DY--QTELI---VRLGE-IDGTLQNSSKLQYEEIYVARALIHRSYSSESHQY--NIALLRLKTSV 126
            .|  |.:|:   ||||| ....:.:.|:..:.::.|.:..:|:.::|....|  :||||||:..|
  Fly   145 GYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPV 209

  Fly   127 VYKKNIQPICI--------DVNV 141
            .|.|.|||||:        |:|:
  Fly   210 RYTKKIQPICLLDAEFPLQDLNL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 37/109 (34%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 40/133 (30%)
Tryp_SPc 108..335 CDD:214473 40/133 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.