DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG34171

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:297 Identity:67/297 - (22%)
Similarity:106/297 - (35%) Gaps:97/297 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVFALLLFYQGSALFLEQNCGKSSV---FSP-----APWLVKIRPEL-----SSNITCTGTLIN 58
            ||.|.||..    ||.|.:|.....:   ..|     :.:||.:|...     ..|..|||.::.
  Fly     3 LAYFLLLKI----ALVLPKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILT 63

  Fly    59 ERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKL------------QYEE--IYVARALIHRSYS 109
            .|.|||:|.||.          :.:|.:.:..::            :.||  :.:...:||..|.
  Fly    64 NRHVLTSAHCIT----------DKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYH 118

  Fly   110 SESHQYNIALLRLKTSVVYKK----NIQPICI---DVNVGKVPKA------------PTF----- 150
            ...|. :||:::||.   |.|    ::.|:.:   .:.||...|.            .:|     
  Fly   119 RNQHN-DIAIIKLKR---YVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLL 179

  Fly   151 -EIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAVGWPLTKQINES----AL 210
             .:|.:..:|..|.|.           ||...|....|:|....       ..||:..:    .|
  Fly   180 VNVELRPFDECLKVKK-----------SLMAARPENEDLICVKS-------TEKQMCTTDFGGPL 226

  Fly   211 F---HQYGI-LSHRNSESKKDV-YTDVMAYVNWITPL 242
            |   ..||| |...|..|...| ::||..|.:|:|.:
  Fly   227 FCDGQLYGIALGSINCSSPDPVFFSDVSFYNSWVTKI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 28/122 (23%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 56/262 (21%)
Tryp_SPc 38..263 CDD:304450 57/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.