DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG9737

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:307 Identity:71/307 - (23%)
Similarity:105/307 - (34%) Gaps:120/307 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SALFLEQNCGKS----------SVFSPAPWLVKIRPELSSNITCTGTLINERFVLTAASCI---- 69
            |...|...|||.          :.....|||..:... |::..|:|.||::|.:||||.|:    
  Fly   134 SGFNLLNECGKQVTNRIYGGEIAELDEFPWLALLVYN-SNDYGCSGALIDDRHILTAAHCVQGEG 197

  Fly    70 --DYQTELIVRLGEI------------------DGTLQNSSKLQYEEIYVARALIHRSYSS-ESH 113
              |.|....|||||.                  |..|.    :.||:|:|     |..|.. .::
  Fly   198 VRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALD----IAYEKIHV-----HPEYKEFSNY 253

  Fly   114 QYN-IALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNW--- 174
            :|| ||::|||..|.:...:.|||:                 ....||.....|.|.....|   
  Fly   254 KYNDIAIIRLKHPVSFTHFVMPICL-----------------PNKSEPLTLAEGQMFSVSGWGRT 301

  Fly   175 ------FLSL------------------------FGVREPRPDVILPPQPIAVGWPLTKQI---- 205
                  |:::                        ||||       |.|:.|..|....|..    
  Fly   302 DLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVR-------LGPKQICAGGEFAKDTCAGD 359

  Fly   206 ---------NESALFHQYGILSHRNSE----SKKDVYTDVMAYVNWI 239
                     .:.:.:..||::|:..::    .|..|||:|..|.:||
  Fly   360 SGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 39/125 (31%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 64/290 (22%)
Tryp_SPc 150..409 CDD:238113 66/291 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.