DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG11842

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:233 Identity:56/233 - (24%)
Similarity:88/233 - (37%) Gaps:68/233 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CTGTLINERFVLTAASCIDYQTE---LIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESH 113
            |.||||::|.|||||.| .|..:   .|.|||:::.. .|:.....|:..|.....|..:|..:.
  Fly   103 CGGTLISDRHVLTAAHC-HYSPQGSVNIARLGDLEFD-TNNDDADPEDFDVKDFTAHPEFSYPAI 165

  Fly   114 QYNIALLRLKTSVVYKKNIQPICIDVNVGK---------------VPKAPTFEIEKKKNEEPKKN 163
            ..:|:::||...|.:.....|.|:..:.|:               ||:.     |.||.::.|..
  Fly   166 YNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRT-----ENKKLQKVKLY 225

  Fly   164 KAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAVGWPLTKQI----NE----------------- 207
            ..|...|          :...|.|.:  |:    |:..|.|:    ||                 
  Fly   226 NYGTRCR----------ITADRNDEL--PE----GYNATTQLCIGSNEHKDTCNGDSGGPVLIYH 274

  Fly   208 ---SALFHQYGILSHRNSESKKD---VYTDVMAYVNWI 239
               ..::|..||.|...:....|   :||.|..|::||
  Fly   275 MDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 27/87 (31%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 56/233 (24%)
Tryp_SPc 73..312 CDD:214473 54/231 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.