DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG10232

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:278 Identity:74/278 - (26%)
Similarity:114/278 - (41%) Gaps:79/278 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEQNCGKS-----SVFSPA------PWLVKIRPE------LSSNITCTGTLINERFVLTAASCI- 69
            |..:||::     ..:..|      ||:..:..|      :::|  |:|:|||:|:|||||.|: 
  Fly   244 LPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNN--CSGSLINKRYVLTAAHCVV 306

  Fly    70 ---DYQTELI---VRLGEIDGT------LQNSSKLQYEEIYVARALIHRSYSSESH-QYNIALLR 121
               ...|:|:   |||||.|.|      ...:....:.||.:....:|..|.:.|. :.:|||:|
  Fly   307 KDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVR 371

  Fly   122 LKTSVVYKKNIQPICIDVNVGKVPKAP------TFEIE---KKKNEEPKK----NKAGIMKRFLN 173
            |:|.|.|...|.|||       |||.|      ..:|.   ..||.|..:    |.....:.:..
  Fly   372 LQTPVRYTHEILPIC-------VPKDPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYENRYYCQ 429

  Fly   174 WFLSLF---------GVR---EPRPDVILPPQPIAVGWPLTKQINE--SALFHQYGILSHRN--- 221
            ..:|.|         |:|   ....|         .|.||...:|.  ..:.:..||:|:.:   
  Fly   430 DKISFFRNESQICASGIRGEDSCEGD---------SGGPLMLTLNNDYQDIVYLAGIVSYGSENC 485

  Fly   222 SESKKDVYTDVMAYVNWI 239
            .:.|..|||...|:.:||
  Fly   486 GDRKPGVYTKTGAFFSWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 41/119 (34%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 71/262 (27%)
Tryp_SPc 260..503 CDD:214473 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.