DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG5255

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:279 Identity:67/279 - (24%)
Similarity:114/279 - (40%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVFALLLFYQGSA---LFLEQNC------GKSSVFSPAPWLVKIRPELSSNITCTGTLINERFV 62
            |.:..|:||...:|   |:..|..      |:.:....||:.:.::...|...:|.|.:|:||::
  Fly     3 LILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67

  Fly    63 LTAASCIDYQTELIVRLGEIDGTL---QNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKT 124
            :|||.|...:.....|:  :.||.   ||.||..|.:    |.:.|.:|:...::.:||||.|..
  Fly    68 ITAAHCTRGRQATAFRV--LTGTQDLHQNGSKYYYPD----RIVEHSNYAPRKYRNDIALLHLNE 126

  Fly   125 SVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNW-FLSLFGVREPRPDV 188
            |:|:....||:.:| :...||                    |.......| .|||.|      ||
  Fly   127 SIVFDNATQPVELD-HEALVP--------------------GSRLLLTGWGTLSLGG------DV 164

  Fly   189 ILPPQPIAVGWPLTKQ---INESALFHQYGILSHRNSESKKDVYTD----------VMAYVNWIT 240
            ....|.:.|.:...:|   .::::.....|.:...|.:.:...:.|          ::|.|||..
  Fly   165 PARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGL 229

  Fly   241 PLAL---DVHITMAPNTDF 256
            |.|.   |.|.:::...||
  Fly   230 PCAKGYPDAHASISYYHDF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 31/102 (30%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 60/253 (24%)
Tryp_SPc 30..252 CDD:238113 60/252 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.