DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG17475

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:125 Identity:35/125 - (28%)
Similarity:61/125 - (48%) Gaps:20/125 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GKSSVFSPAPWLVKIRPELSSNITCTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKL 92
            |:......|.:.:.::.....:| |.|.:|:||.|||||.|:.......:|:  |.||      :
  Fly    53 GEDVQLGEAKYQISLQGMYGGHI-CGGCIIDERHVLTAAHCVYGYNPTYLRV--ITGT------V 108

  Fly    93 QYEE----IYVARALIHRSYSSESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAP 148
            :||:    .:|....||.:|:|..:..:|||:||..::.:.:..||       .::|.||
  Fly   109 EYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQP-------AELPTAP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 30/103 (29%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 35/125 (28%)
Tryp_SPc 50..269 CDD:238113 35/125 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.