DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG31326

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:253 Identity:67/253 - (26%)
Similarity:98/253 - (38%) Gaps:56/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GKSSVFSPAPWLVKIRPELSSN---ITCTGTLINERFVLTAASCIDY------QTELIVRLGEID 83
            |||......||||.|.....||   ..|.||||:...||:||.|...      .:.|.|.||.  
  Fly   277 GKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGR-- 339

  Fly    84 GTLQNSSKLQYEEIYVARALIHRSYS-SESHQYNIALLRLKTSVVYKKNIQPICI--DVNVGKVP 145
            .||...|..::..  |::.:||.::. .:..:.::||:||...|.|...|.|||:  ..|...:|
  Fly   340 NTLAIHSDGEFRG--VSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLP 402

  Fly   146 K---------APTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAV---- 197
            :         .|. |......|..|.....|:.. .|..|.|       |.|::.|..:..    
  Fly   403 QGLKSYVAGWGPD-ETGTGNTEVSKVTDLNIVSE-ANCALEL-------PHVLVQPSSLCAKKTG 458

  Fly   198 --------GWPLTKQINESALFHQYGILS-------HRNSE-SKKDVYTDVMAYVNWI 239
                    |.||  .:.|..::...|::|       ....| ||..|:|||..::.|:
  Fly   459 AGPCASDGGGPL--MLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 36/109 (33%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 67/253 (26%)
Tryp_SPc 277..514 CDD:214473 66/251 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.