DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG9649

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:272 Identity:58/272 - (21%)
Similarity:100/272 - (36%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FYQGSALFLEQNCGKSSVF-------------SPAPWLVKIRPELSS--NITCTGTLINERFVLT 64
            ||..:...|...||:..|.             ...||:..:...:..  |..|.||||:.|.|::
  Fly   234 FYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVIS 298

  Fly    65 AASCIDYQT------ELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESH-QYNIALLRL 122
            ||.|..:.:      ..||.||.....|.:|.    ..:.|||.|||..|:...: ..::|||:|
  Fly   299 AAHCFRFGSRNLPGERTIVSLGRNSLDLFSSG----ATLGVARLLIHEQYNPNVYTDADLALLQL 359

  Fly   123 KTSVVYKKNIQPIC-------IDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNW------ 174
            ...|.....|:|||       :::..|.......:..::|.|...:..|.........|      
  Fly   360 SNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNL 424

  Fly   175 ------FLSLFGVREPRPDVILPPQPIAVGWPLTKQINESALFHQYGILS------HRNSESKKD 227
                  |::...:.........|....:.|..:   :.|..::...|::|      :|.:.:...
  Fly   425 SEENAKFITSHTICASNAQASGPCSGDSGGGLM---LQEQDIWMLRGVVSAGQRMTNRCNLTLPV 486

  Fly   228 VYTDVMAYVNWI 239
            :||||..::.|:
  Fly   487 IYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 35/115 (30%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 51/247 (21%)
Tryp_SPc 259..497 CDD:214473 51/244 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.