DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG8870

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:105/265 - (39%) Gaps:67/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GKSSVFSPAPWLVKI----RPELSSNIT--CTGTLINERFVLTAASCI-----DYQTEL-IVRLG 80
            ||....:..||:..:    :..||..:.  |.|:|||..:|||||.|:     ||...| .||||
  Fly    87 GKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLG 151

  Fly    81 E-----------IDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYN-IALLRLKTSVVYKKNIQ 133
            |           ::|..|.:.  .|.||.|.:.:.|..::......| |||:|||..|.|.:.||
  Fly   152 EHNTSTNPDRAIVNGRRQYAP--LYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQ 214

  Fly   134 PICIDVNVGKVPKAPTFEIEKKKNEE---PKKNKAGIMKRFLNWFLSLFGVREPRPDVI------ 189
            |||:       |:|......|:|.:.   |...: ||....|   |..| :.|..|||.      
  Fly   215 PICL-------PRAQKLAAHKRKFQASGWPDMGQ-GIASEVL---LRSF-IAERHPDVCKSNYDF 267

  Fly   190 -LPPQ------------PIAVGWPLTKQI--NESALFHQYGILSHRN-----SESKKDVYTDVMA 234
             |..|            |...|.||.:.:  .:..|.:..||:|:..     ...|...||....
  Fly   268 NLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSY 332

  Fly   235 YVNWI 239
            :..||
  Fly   333 FFEWI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 43/123 (35%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 73/259 (28%)
Tryp_SPc 93..337 CDD:214473 71/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.