DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and snk

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:240 Identity:56/240 - (23%)
Similarity:100/240 - (41%) Gaps:68/240 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CTGTLINERFVLTAASCIDYQTEL--IVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQ 114
            |.|.|::|.:|||||.|....::.  :||||   ....|.:....::|.:...::|..|.|.::.
  Fly   220 CGGALVSELYVLTAAHCATSGSKPPDMVRLG---ARQLNETSATQQDIKILIIVLHPKYRSSAYY 281

  Fly   115 YNIALLRLKTSVVYKKNIQPICI------------------------------DVNVGKVPKAPT 149
            ::||||:|...|.:.:.::|.|:                              .|::..||:...
  Fly   282 HDIALLKLTRRVKFSEQVRPACLWQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTC 346

  Fly   150 FEIEKKKNEEPKKNKAGIMK-RFLNWFLSLFGVREP-RPDVILPPQPIAVGWPLTKQINESALFH 212
            .:|.:|:...|:    ||:: :|...:|.  |.|:. :.|         .|.|:      .||..
  Fly   347 KQIYRKERRLPR----GIIEGQFCAGYLP--GGRDTCQGD---------SGGPI------HALLP 390

  Fly   213 QY-------GILSHRN---SESKKDVYTDVMAYVNWITPLALDVH 247
            :|       ||.|...   :.:...|||.:.:|::||..:|...|
  Fly   391 EYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKIAFKQH 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 26/86 (30%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 54/233 (23%)
Tryp_SPc 186..427 CDD:214473 52/230 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.