DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and MP1

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:287 Identity:74/287 - (25%)
Similarity:111/287 - (38%) Gaps:94/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NCGKS----------SVFSPAPWLVKIRPELSSNIT---CTGTLINERFVLTAASCI-----DYQ 72
            |||::          :.....||:..|......|:.   |.|:|||.|:|||||.|:     |: 
  Fly   129 NCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDW- 192

  Fly    73 TELI-VRLGEIDG------TLQNSSKLQYEEIY----VARALIHRSYSSESH-QYN-IALLRLKT 124
             ||. |||||.|.      |:..:.:....|.|    |...:.|..|...|. |.| ||||||:.
  Fly   193 -ELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRD 256

  Fly   125 SVVYKKNIQPICI--------DVNVGK-----------------------VPKAPTFEIE----- 153
            .|.|...|.|:|:        ::.:|:                       :...||.|..     
  Fly   257 EVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYAT 321

  Fly   154 KKKNEEPKKNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAVGWPLTKQ--INESALFHQYGI 216
            :::....|:..||          .:.||...|.|         .|.||..:  .|.::.::..|:
  Fly   322 QRRTVTTKQMCAG----------GVEGVDSCRGD---------SGGPLLLEDYSNGNSNYYIAGV 367

  Fly   217 LSHRNS----ESKKDVYTDVMAYVNWI 239
            :|:..:    :....|||.|.||:|||
  Fly   368 VSYGPTPCGLKGWPGVYTRVEAYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 44/120 (37%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 69/277 (25%)
Tryp_SPc 138..397 CDD:238113 71/278 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.