DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG14088

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:266 Identity:73/266 - (27%)
Similarity:112/266 - (42%) Gaps:56/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVFALLLFY---QGSALFLEQNCG-KSSVFSP---APWLVKIRPELSSNITCTGTLINERFVLT 64
            :||...||.:   .|||.||...|| :....||   .||...:..  ...|...||||:|||:||
  Fly     8 VAVLTSLLIFLSGTGSAQFLGNICGERRDGLSPDIVGPWTAILHH--FGRIVGVGTLIHERFILT 70

  Fly    65 AASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKTSVVYK 129
            ...|.|....:..||||. |.:  .|:|..:.| ||....:.:::.|:...|:.|::|..:||||
  Fly    71 DVHCGDSIGVIRARLGEY-GRI--GSELAEDHI-VAAFFSNANFNPETQANNMGLMKLLRTVVYK 131

  Fly   130 KNIQPICIDVNVGKVPKAPTFEIE---------KKKNEEPKKNKAGIMK-----------RFLNW 174
            ::|.|:||.::    .:..||..|         |..::.|......:::           :|...
  Fly   132 EHIIPVCILMD----SRMQTFADELDYFNGTTWKNSDKSPMLRSKTVIRMPQACGKLDHGQFCAG 192

  Fly   175 FLSLFGVREPRPDVILPPQPIAVGWPLTKQI-----NESALFHQYGILSHRNSESKKDVYTDVMA 234
            ...|....||.            |..||::|     |.:.||.....:..:.|.|:  .||||:.
  Fly   193 HKDLDSCDEPS------------GAALTREIDYIGPNRTVLFGIANSVEVKCSNSR--TYTDVVQ 243

  Fly   235 YVNWIT 240
            ...||:
  Fly   244 LHQWIS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 34/99 (34%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 60/232 (26%)
Tryp_SPc 42..248 CDD:214473 58/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.