DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG18223

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:307 Identity:62/307 - (20%)
Similarity:109/307 - (35%) Gaps:114/307 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VFALLLFY--------QGSAL---FLEQNCGKSSVFSP----------APWLVKIRPE-----LS 47
            :|:.|||.        .|..:   |:.:...:.|  ||          |.::|.||..     ..
  Fly    12 IFSFLLFLLLLLPILDAGDPIGSHFVRRRAKRLS--SPYFDKEKTLVLAKYVVSIRSRRPHKLFG 74

  Fly    48 SNITCTGTLINERFVLTAASC------IDYQTELIVRLGEIDGTLQN----SSKLQYEEIYVARA 102
            .|..|.|.:|:..::||:|.|      |.:::.::|.:......|::    |..::.::|:|...
  Fly    75 DNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDK 139

  Fly   103 LIHRSYSSESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGI 167
            .      :..:..||||:.|...:.....:      |.|..:|.|         :.||     |:
  Fly   140 F------TVFNTNNIALMMLAKKLPLDNPL------VGVINLPTA---------DPEP-----GL 178

  Fly   168 MKRFLNWFLSLFGVREPRP--------DVILPPQPIA---------------------------- 196
            ....|.|.....|    .|        ||.|.|:.|.                            
  Fly   179 NYTVLGWGRIFKG----GPLASDILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAG 239

  Fly   197 -VGWPLTKQINESALFHQYGILSHR---NSESKKDVYTDVMAYVNWI 239
             .|.||.  .||:.    :|::|:|   .|::...:||:|..:::||
  Fly   240 DTGSPLI--FNETV----FGVVSYRVGCGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 22/114 (19%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 52/257 (20%)
Tryp_SPc 60..280 CDD:214473 50/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.